SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|429191753|ref|YP_007177431.1| from Natronobacterium gregoryi SP2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|429191753|ref|YP_007177431.1|
Domain Number 1 Region: 18-135
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000131
Family Cgl2762-like 0.052
Further Details:      
 
Weak hits

Sequence:  gi|429191753|ref|YP_007177431.1|
Domain Number - Region: 247-361
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0022
Family DnaQ-like 3'-5' exonuclease 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|429191753|ref|YP_007177431.1|
Sequence length 367
Comment transposase [Natronobacterium gregoryi SP2]
Sequence
MGGDRRGELVRHLSEEELDRLLDEADDPKVVKRLTFVKRLYKGATYEEAADDVGKSASTG
SRWARRWNDGGLGQLTPNFGGGRPPKLGDEEQECLLELLREGQPWKAQEVHQLLDAEFDV
EYHPDYLGRFLRNLGLSYAKPRPKRPSRPENADEILEERVADAFDEETETAHNKRPEDED
EGWVLDDDICTDGGTIVGFCDASHPQPYDNSHRLWYVDDPTLERPLVKLDEPAVGCYTLN
GESVLTFPEDQSKENICALLEEVREQNPGTRILLVLDNFSSHICEHTRKRAHQLGIDLVF
LPVGSPHLNTIEQVWKVLKRNASPIVVASESAFRTLARRLFNTLTDRLGFAKSWIDQFLS
PYLQKLS
Download sequence
Identical sequences L0AIH8
gi|429191753|ref|YP_007177431.1| WP_015233478.1.71579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]