SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|429191758|ref|YP_007177436.1| from Natronobacterium gregoryi SP2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|429191758|ref|YP_007177436.1|
Domain Number 1 Region: 1-199
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.44e-64
Family Phosphate binding protein-like 0.0000916
Further Details:      
 
Domain Number 2 Region: 210-284
Classification Level Classification E-value
Superfamily GlnB-like 5.23e-19
Family ATP phosphoribosyltransferase (ATP-PRTase, HisG), regulatory C-terminal domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|429191758|ref|YP_007177436.1|
Sequence length 285
Comment ATP phosphoribosyltransferase [Natronobacterium gregoryi SP2]
Sequence
MRIAVPNKGRLHEPTIDLLERAGLHLENGADRKLYADTVDSDVSVLFARAADIPEYVADG
AADMGITGYDQIREARVESVAELLDLEFGSCRLVLAAPEDGDIETVADLEGGTVATEFPN
ITRNFFAESGVDPDVVEVTGATELTPHVEMADAIVDITSTGTTLKMNRLAVVEEVLSSSV
RLFAREDVLEEPKVEEVRTALASVKQAEGKRYLMMNVPGGRLDDVRDVIPGMGGPTVMDI
ADEDDDGKVAVHAVVDEHDVFETITEVKNAGASDVLVTEIERLVE
Download sequence
Identical sequences A0A1I3SU23 L0AII3
gi|429191758|ref|YP_007177436.1| WP_005578230.1.6326 WP_005578230.1.71579 WP_005578230.1.8181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]