SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|429191774|ref|YP_007177452.1| from Natronobacterium gregoryi SP2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|429191774|ref|YP_007177452.1|
Domain Number 1 Region: 107-238
Classification Level Classification E-value
Superfamily Ribonuclease H-like 5.56e-16
Family Ribonuclease H 0.0034
Further Details:      
 
Weak hits

Sequence:  gi|429191774|ref|YP_007177452.1|
Domain Number - Region: 46-90
Classification Level Classification E-value
Superfamily DNA helicase RuvA subunit, C-terminal domain 0.051
Family DNA helicase RuvA subunit, C-terminal domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|429191774|ref|YP_007177452.1|
Sequence length 244
Comment ribonuclease HI [Natronobacterium gregoryi SP2]
Sequence
MVRPVDKSDRKRGRESRQPKLEGASSVTDDRLPSEHCSPLAALVDEVLAGVGYEVAAATD
AIDDAVPGDGGLFDPGTNPDELRRALESLLESGLGRPPVPGSTSDAFVLYVYGSSRGNPG
PAGAGAVIVDASAREELARLGRPVGSRTGNNTAEYVALELGLSELLARYEPRRLEVRIDS
MTVIRDVWGGEDPTEPGVETYSEAVAAALSSVPDHRYTHLADSDPNPADALATVGADIAA
FGPG
Download sequence
Identical sequences A0A1I3TWB2 L0AGG8
gi|429191774|ref|YP_007177452.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]