SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|429191877|ref|YP_007177555.1| from Natronobacterium gregoryi SP2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|429191877|ref|YP_007177555.1|
Domain Number 1 Region: 75-194
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 7.73e-18
Family Tetracyclin repressor-like, C-terminal domain 0.0066
Further Details:      
 
Domain Number 2 Region: 3-70
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000012
Family Tetracyclin repressor-like, N-terminal domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|429191877|ref|YP_007177555.1|
Sequence length 232
Comment transcriptional regulator [Natronobacterium gregoryi SP2]
Sequence
MTDPDVRDEIMRATYEALCEHGYTDLTAQDIADRTNKSKSLLFYHYDSKEDLVADFVDYL
VDWLGERVEMTEELPPVERLATFVDWFLYGSTDDDDKRQSFHTAMLEIRTQAPYNAQYRE
QLRRTDDRLREIVEEILRDGVEAGEFVDHDAEETAALLIATLDGARIRQLTLEHDVYLEQ
VRSAIVARIFADLLAEDVSFPTESLPAEEWERAWPSLDKPGGGDETADDDHE
Download sequence
Identical sequences A0A1I3JLK2 L0AH46
WP_005577776.1.6326 WP_005577776.1.71579 WP_005577776.1.8181 gi|429191877|ref|YP_007177555.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]