SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|429192351|ref|YP_007178029.1| from Natronobacterium gregoryi SP2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|429192351|ref|YP_007178029.1|
Domain Number 1 Region: 20-108
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000708
Family Cgl2762-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|429192351|ref|YP_007178029.1|
Sequence length 113
Comment hypothetical protein Natgr_2410 [Natronobacterium gregoryi SP2]
Sequence
MGGDRRGDLGRHLSEEELDRLLDEEDDPKIIKRFSFVKRLYKGATYEETADDVGKSASTG
SRWERRWNDGGLGQLTPNFGGGRPLKLGDEEQERLLRLLREGQPWKAQEKGLL
Download sequence
Identical sequences A0A1I3QPH0 L0AKK8
gi|429192351|ref|YP_007178029.1| WP_015233617.1.71579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]