SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|429192422|ref|YP_007178100.1| from Natronobacterium gregoryi SP2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|429192422|ref|YP_007178100.1|
Domain Number 1 Region: 78-210
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000116
Family Retroviral integrase, catalytic domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|429192422|ref|YP_007178100.1|
Sequence length 211
Comment transposase [Natronobacterium gregoryi SP2]
Sequence
MAKIARLSGRSDWIELDFVERERTPRQLMKLGIRLHLAGLSLSNTVRELEKFGVKRSRKA
VHDWVQKADLQLASNASPDHVALDETVIRINGQQFWLYAAVDPDTNDFLHVRLFTTTTTA
LTQRFLQELREKHDVDDAVFLVDHAHHLATALQRIGLRFRPERHGNRNAIERVFREIKRR
TSSFSNSFSHVDPSTAETWLQAFAVWWNLRN
Download sequence
Identical sequences A0A1I3MTD8 L0AIP1
gi|429192422|ref|YP_007178100.1| WP_005579631.1.6326 WP_005579631.1.71579 WP_005579631.1.8181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]