SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|429192428|ref|YP_007178106.1| from Natronobacterium gregoryi SP2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|429192428|ref|YP_007178106.1|
Domain Number 1 Region: 371-540
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000159
Family Transposase inhibitor (Tn5 transposase) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|429192428|ref|YP_007178106.1|
Sequence length 576
Comment transposase family protein [Natronobacterium gregoryi SP2]
Sequence
MSTDPSAVAESIIVHAETLCEREDHLWDVIRKLSIPVDELEDARDQNRVTFGTDEMFRTL
LFKGIRGISQNKIAQRLGREPSLVKSFHLDITDLSNTPTQQELSYAHAKFSENTQKILNR
TVAGVRQEALDNGVLTEGLVPSVPAETEEESQSENEYKKEKAQKTLTLARKHVIPEFDTH
RAAHKKYSDEVMLDMFASICANNGSAHSEAEYGWLTDDDLICDDSTFLRAIKKIATPEDS
DGQLTLEDFEDDDSMPEIDQIRDTIMTAFNAATENIINSIRGDDPFDSRETVAAIDITHE
QFHVWPWEDKEAGIAKPDYPKMVSGYKKDGEYKRGYKYATITLVGDHAPIVLGIEPVKED
SAWEPDDSPSYSKADLVSRLLDRAEQFVDLDMVMFDRGFYVNRVYADVHERGLTYLSPVP
TYEDDLEAIQDIQEHPTANEAVKHNVPFGIDGEIHHEAEFLYAPSTSDDADGKYAVFVTN
QDRVEPEEISSVVNGYSRRWDIENQYKSIKDFMPKTSSTDYRLRLCNFALSTLIYNLWRL
TDYLIKVALDEPIRSPPVITAKTFVRALGDFLREFG
Download sequence
Identical sequences A0A1I3MTS3 L0AKH3
WP_005579636.1.6326 WP_005579636.1.71579 WP_005579636.1.8181 gi|429192428|ref|YP_007178106.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]