SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|429192523|ref|YP_007178201.1| from Natronobacterium gregoryi SP2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|429192523|ref|YP_007178201.1|
Domain Number 1 Region: 10-159
Classification Level Classification E-value
Superfamily Resolvase-like 1.01e-22
Family gamma,delta resolvase, catalytic domain 0.001
Further Details:      
 
Weak hits

Sequence:  gi|429192523|ref|YP_007178201.1|
Domain Number - Region: 186-221
Classification Level Classification E-value
Superfamily Homeodomain-like 0.034
Family FIS-like 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|429192523|ref|YP_007178201.1|
Sequence length 237
Comment site-specific recombinase, DNA invertase Pin [Natronobacterium gregoryi SP2]
Sequence
MAQSDTKSTLIYARVSTEDQDLSHQEENLWNYATDSLGFPEDDIDVLRDKSTGTNIDRSG
YREMMERVRAGDAESIIVREISRIGRDIRDIHDTVYEIVDDHDCGLYIKNDGLEVDADEE
LDIAFKSTMFGLSLAAEIKAKKVKENTLEGLRAAEQAGKCTTRPPYGFTTDDEGYLQPTD
EFSNAREAIEAVEELGWSHRKTARHTGVPRRTIPNILERKDLYLTTTIDRGDPGESA
Download sequence
Identical sequences A0A1I3RSY1 L0AKQ0
gi|429192523|ref|YP_007178201.1| WP_005580380.1.6326 WP_005580380.1.71579 WP_005580380.1.8181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]