SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|429192565|ref|YP_007178243.1| from Natronobacterium gregoryi SP2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|429192565|ref|YP_007178243.1|
Domain Number 1 Region: 6-198
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000000000184
Family DnaQ-like 3'-5' exonuclease 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|429192565|ref|YP_007178243.1|
Sequence length 222
Comment exonuclease [Natronobacterium gregoryi SP2]
Sequence
MTLEQVAFDIETTGFGVDDVVTTVGFAVPLGVRVFVQTDGRAAPDVEAAVRDRVETHVKV
STHESERALFEAVSGFVETRFRDEDVLLVAYNGERWKGGFDIPFLRTRYAHHDIDWPFTD
VPYADVMPLVTTRFNTTISGEDEPRGDLAGVYDALCDGKYSDLDPFTESSEAVTAYENDR
FAELVVHNVADVLRTRSLGRLAERYCSKSDFNVKSLTPTTEG
Download sequence
Identical sequences A0A1I3SD51 L0AK14
gi|429192565|ref|YP_007178243.1| WP_015233669.1.6326 WP_015233669.1.71579 WP_015233669.1.8181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]