SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|429192566|ref|YP_007178244.1| from Natronobacterium gregoryi SP2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|429192566|ref|YP_007178244.1|
Domain Number - Region: 120-161
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00442
Family TrmB-like 0.03
Further Details:      
 
Domain Number - Region: 171-244
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0282
Family Recombinase DNA-binding domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|429192566|ref|YP_007178244.1|
Sequence length 354
Comment restriction endonuclease [Natronobacterium gregoryi SP2]
Sequence
MTDSESRSHDDASTESTKKSAAEKNGHCECHETVDPETREDVLAKYKHRCQSCGRCGPEK
GGLATLHVHHIERDPDGMDEHDMENLSLLCRACHSWLHQQSTPDDSPVEITDEDRSVLLP
QDIEILRFLAANGPLRTGEIASGLPLELSVSAVRERLWVLMGLDNRVESRDQQLVDKDVE
TGEWGLTEQIENSARGHIPDDQQLLLQRMEDEQVRQALERGCDRSAVTDVLGISRRTTFN
KVKRAYAYDFPLDAFSRGGRPSEETGPDQNATADETPADESDEQQRLDAVAEGEDESLGR
TETWGTPKSESTVQSADVNEQRTDRVASDGSGGNELREHLRRAIDALQEVDEAL
Download sequence
Identical sequences A0A1I3SGC5 L0AL67
WP_015233670.1.6326 WP_015233670.1.71579 WP_015233670.1.8181 gi|429192566|ref|YP_007178244.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]