SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|429192580|ref|YP_007178258.1| from Natronobacterium gregoryi SP2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|429192580|ref|YP_007178258.1|
Domain Number 1 Region: 340-560
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000022
Family Transposase inhibitor (Tn5 transposase) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|429192580|ref|YP_007178258.1|
Sequence length 609
Comment transposase family protein [Natronobacterium gregoryi SP2]
Sequence
MMTESTVRGGKAVHSDAYIHDLDSSKANHTSEVDLGYQHDPTGEDYGPVAQRGQDVELEH
PVEDVEELYHEAHLTVQFGEANRSGENDENEPSDGLSEESAAEFDKTVLQFAERALCEEG
VSLDELPEKPRRVRALLLHDAWAMESYPRLVAHFEELEATAQKLGFSSIPDQSTFWRTHN
ALREDGYRESIQNAATRVVHAVARRGIIVPESAVTAHGLDVSVPIDEGEVAGETRRAAIR
HWVDSLLDELLEPISFDRSKNLQHAVKAIIAAVAQGAYAHGLNSARPTASWHYETSEIPT
AGQVSRLLRSVDTQEILRMFTDINRRFIQIASAHGFFDRDYNYALDTTWVKYEGKHVGED
GELKLIENPKQGDKGIGWLFAVLCVMDIDARFALGLNLVEDKSETTEQFRFLLRTAAREG
GVNRVHIDREFYDGDAVRMCRAIAGRNWVIRAKRQGEAAELLAETPEGKSNSRRNINFAD
VTPGPNLYVYPVPEKFRDDAGHTHMAFLSDLDPDDTPAAEIFDTYSKRWSVETLLRQLKH
DVGVETSSPYPKMRLFLLQIATLCYNIHTLMNRATSPKYALRLDVPYYEVLLAIVDVVYT
RRGATELNR
Download sequence
Identical sequences A0A1I3SDY6 L0AK29
WP_005580451.1.6326 WP_005580451.1.71579 WP_005580451.1.8181 gi|429192580|ref|YP_007178258.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]