SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|429192656|ref|YP_007178334.1| from Natronobacterium gregoryi SP2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|429192656|ref|YP_007178334.1|
Domain Number 1 Region: 12-78
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000446
Family Tetracyclin repressor-like, N-terminal domain 0.009
Further Details:      
 
Domain Number 2 Region: 83-197
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.000000000000153
Family Tetracyclin repressor-like, C-terminal domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|429192656|ref|YP_007178334.1|
Sequence length 205
Comment transcriptional regulator [Natronobacterium gregoryi SP2]
Sequence
MLVVGKKLFENPSGTREEILAATYRALVEHGYADLTITRIGDELEKSQSLIYHHYDGKDD
LVLACLEFMLAEFESTMDDSEIEDPRARLEAAVDWMFACEFDDEHQQFFATTLELRARAN
YDPAYRDHFTRSDRAFDRQLTTIVREGIEQSVFQECDPEAVASTLTTLQTGALFRRVSAD
GTEWLADVREEIDVYLEQQVYATSE
Download sequence
Identical sequences A0A1I3SKZ6 L0ALF3
WP_005580533.1.6326 WP_005580533.1.71579 WP_005580533.1.8181 gi|429192656|ref|YP_007178334.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]