SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|429193171|ref|YP_007178849.1| from Natronobacterium gregoryi SP2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|429193171|ref|YP_007178849.1|
Domain Number 1 Region: 51-154
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000000622
Family Retroviral integrase, catalytic domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|429193171|ref|YP_007178849.1|
Sequence length 166
Comment transposase [Natronobacterium gregoryi SP2]
Sequence
MDDEYTILTIDQTRQVLSTLIYAWFPEGERPSLPVTGAWDSIKLLGAVSNSGETFFLPCE
ENFNSDTTIRLLDALQTEFGEKICVVLDNASYFTANKVQAFAEGTPIELCYLPRGSPELN
PVEECWRRLNQALGNRLFNTLDELQEAALTALDDIEPPNVFTYLCP
Download sequence
Identical sequences A0A1I3TZT1 A0A1J4LW89 L0AMU8
gi|429191751|ref|YP_007177429.1| gi|429193171|ref|YP_007178849.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]