SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|429193256|ref|YP_007178934.1| from Natronobacterium gregoryi SP2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|429193256|ref|YP_007178934.1|
Domain Number 1 Region: 299-487
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000000006
Family DnaQ-like 3'-5' exonuclease 0.03
Further Details:      
 
Domain Number 2 Region: 239-291
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.000000138
Family DNA repair protein Rad51, N-terminal domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|429193256|ref|YP_007178934.1|
Sequence length 543
Comment hypothetical protein Natgr_3362 [Natronobacterium gregoryi SP2]
Sequence
MTPRAGVTVLALRPSAIADRPVATLEDLVATLEPDTVWVFGPERDPQAFARARSVFDAPA
VHPPLETAGDGPLARRVLEPASPDDGNGSSLEIAVTPGTRALRAEPDATSRTLRDGIAAL
VCDNVTTVTRPTTLETHLDGAAALAEALPAGAVTTVLTGSEPAGYDAVWHLESETGAVRD
IDHETVGGVEPLAEDCVSVRVRGAGPTEGYDDRGSIATLTLTSAGIAGVDTYDVTDFGLE
AVTGIGPKTADRLANRGVTTRTDLLETSSATLTDLPGVGRERARTIHQHARVLETGEPRR
LTDASLPGADWYEPPLCLDIETDGLSPTIIWQIGIYDPATDDYRAFVERDDPSDPASVLE
AFCDWLFGMHPNRALLTWNGWGFDYRHLGAFVSKHVPYYAEEWESIPKLDLYLWAVNNEH
ALLPGRTNELAVVADALGYDDADTGLDGAATAAAYQQFMRTGDALAWDRHEAYCEDDCRA
LWHVYECLRDAPQASSAGSSSGDSSRERTATTSANGEADRGTPTSDRSSSPTEETEQTGL
SDF
Download sequence
Identical sequences A0A1I3RHF4 L0AN28
gi|429193256|ref|YP_007178934.1| WP_005576866.1.6326 WP_005576866.1.71579 WP_005576866.1.8181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]