SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|429193382|ref|YP_007179060.1| from Natronobacterium gregoryi SP2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|429193382|ref|YP_007179060.1|
Domain Number 1 Region: 85-238
Classification Level Classification E-value
Superfamily Ribonuclease H-like 8.35e-24
Family DnaQ-like 3'-5' exonuclease 0.037
Further Details:      
 
Weak hits

Sequence:  gi|429193382|ref|YP_007179060.1|
Domain Number - Region: 4-32
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 0.0736
Family DNA polymerase beta-like, second domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|429193382|ref|YP_007179060.1|
Sequence length 250
Comment exonuclease [Natronobacterium gregoryi SP2]
Sequence
MRIENSFIPVHGVGETTERRLWENGITHWEEFDGSVVGDTLADRIDAFIDDGWTHLDDGD
VSPFAERLPASSRWRLYENVRQETCFLDIETTGLDASCNDVTTVSLHRGGDTKTFVQGRD
LTANRLSRELEESALLVTFNGQRFDVPFLETCYDLEISVPHVDLLYPCKKLGLDGGLKAI
EQEVGIERDHPDISGRDAVRLWHEYERGDESALETLVEYNRADTKNMQPLLDVVADRLHE
AVFEAARQPE
Download sequence
Identical sequences A0A1I3QA14 L0ALG7
gi|429193382|ref|YP_007179060.1| WP_005576613.1.6326 WP_005576613.1.71579 WP_005576613.1.8181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]