SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|429193435|ref|YP_007179113.1| from Natronobacterium gregoryi SP2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|429193435|ref|YP_007179113.1|
Domain Number 1 Region: 104-358
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.29e-26
Family Transposase inhibitor (Tn5 transposase) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|429193435|ref|YP_007179113.1|
Sequence length 424
Comment transposase family protein [Natronobacterium gregoryi SP2]
Sequence
MRRLTTLFPSEFLEEHAEELGVIGRDRKLQIPAFVWAFVFGFAAGESRTLAGFRRSYNST
ADETTSPGGFYHRLTPSPAEYFRDLVERGLDEVAVPDTVDADIDRFKDVMIADGTVLRLH
EFLADEYEARKEEQAGAKLHLLHNATEQTIERLDVTDEKTHDSTLFHTGSWLEDRLVLFD
RAYFKYRRFALIDENDGYFVSRLKESANPVVTEELREWRGRAIPLEGEQIHDVVDDLHRE
YIDVEVEAEFDRRPYGGTQSRHTKRFRVVGVRKEDADDYHLYITNLPREEFLPSDLGTIY
RCRWEVELLFRELKTQYELDEFDTTKKHVVEILLYAALLSLLVSRELLDLVTEQADGEIV
FPPERWAATFRSHAQLILHELGEYLGYSPPPLLDRLIDDAQKIHQQRPVLQETLATATQP
RCES
Download sequence
Identical sequences L0AMJ1
gi|429193435|ref|YP_007179113.1| WP_015233873.1.71579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]