SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|429193172|ref|YP_007178850.1| from Natronobacterium gregoryi SP2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|429193172|ref|YP_007178850.1|
Domain Number 1 Region: 37-143
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000156
Family Homeodomain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|429193172|ref|YP_007178850.1|
Sequence length 181
Comment transposase [Natronobacterium gregoryi SP2]
Sequence
MATFENVSVEDLRQILAEVDDADATKRLMAAITYKEIEDLTQAEAAALYGFSSSWASKWF
NRLERLADEPFEEVVYDKPREGRPSELSDDEHEQFVEVLHESPEDVGYDAPAWSVSLARH
YLSEEFGVEYCERHVRRLMSEAGLSWKTARPEFHKSDERAQEAWEEGFKKSATTWTMNTR
S
Download sequence
Identical sequences L0AKR6
gi|429193172|ref|YP_007178850.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]