SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|409995927|ref|YP_006750328.1| from Lactobacillus casei W56

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|409995927|ref|YP_006750328.1|
Domain Number 1 Region: 4-301
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 1.44e-44
Family ADP-ribosylglycohydrolase 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|409995927|ref|YP_006750328.1|
Sequence length 312
Comment hypothetical protein BN194_02620 [Lactobacillus casei W56]
Sequence
MGIMESRLIHGTVGFAIGDALGLPVKGQNAAELTAAPVTTMKGYGTFNQPAGTYSDETGL
ALAGLDALQHGFDEQALIKAYQAWFTAGKYAPYGKRSPDIWPSIETALKTGQSVAAAKEP
GALIRILPFAFFAYQTFDTSLFQKAEGVKVLKTFVHITNQDAENLVAAGIYMQIAVELLG
ATPNLSSAIATGINKAGSYFGTTQPYQPIFEAFQAVLADDKWPDGSATDPISLLARTLKA
LQSKPDYHDAVLQTVNQGGATDTTGALVGGLAGLAYGYTSLPHRWCLMLAEYAQIVDLCR
QAENSGFFPKYD
Download sequence
Identical sequences A0A125U6J7 A0A2J2H0T8 K0N7N3
gi|191637077|ref|YP_001986243.1| WP_012490870.1.13224 WP_012490870.1.24722 WP_012490870.1.25220 WP_012490870.1.33776 WP_012490870.1.39141 WP_012490870.1.44079 WP_012490870.1.45928 WP_012490870.1.62572 WP_012490870.1.63838 WP_012490870.1.88086 gi|385818777|ref|YP_005855164.1| gi|409995927|ref|YP_006750328.1| 543734.LCABL_02550 gi|385821952|ref|YP_005858294.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]