SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|443488646|ref|YP_007366793.1| from Mycobacterium liflandii 128FXT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|443488646|ref|YP_007366793.1|
Domain Number 1 Region: 64-490
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.15e-101
Family Pyridoxal-dependent decarboxylase 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|443488646|ref|YP_007366793.1|
Sequence length 502
Comment glutamate decarboxylase [Mycobacterium liflandii 128FXT]
Sequence
MSRDVSDFAGEFVSGSGTAAYRDAITLASGLVANALEAADAPGLVDGYSLLKELADKPRL
DTVAGVGLPAALEEAVGLMAGYSAVVTHPAYLAHLHCPPTVASLSAEVLISAFNQSLDSF
DQAPAATAIEQRVVEHLCARIGYGTDADGAFTSGGTQSNLHALLMARDVFAQRTLGLDVG
TAGLPAAARSWRLLCTRQAHFSARQALRILGLGADAVIEVPTDDAGRLCVEALAGCIAES
QARGTPVFGLFLTAGTTDYGAIDPLEPAIKIARQHGVWAHVDACVGGCLAFSAQHRHLLR
GIELADSVAVDFHKLLFQAISCSALLVRDAESFRVSACHADYLNPADDVEHDVVNLVGKS
LQTTRRFDALKIFLTLRALGERRIGAMIDATCAAAAAAGRAVSDHPHLTLCAPVAVNTVV
LRWRHPELTEQKCDAVNSAIRSSLARCGLALVGRSRAAGHQAIKLTFVNPLITADLATGV
IADVSRRGNEIAGLPDDLAAQA
Download sequence
Identical sequences L7UY15
gi|443488646|ref|YP_007366793.1| WP_015353998.1.5386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]