SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|443491083|ref|YP_007369230.1| from Mycobacterium liflandii 128FXT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|443491083|ref|YP_007369230.1|
Domain Number 1 Region: 290-512,551-766
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.73e-73
Family Ornithine decarboxylase major domain 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|443491083|ref|YP_007369230.1|
Sequence length 943
Comment amino acid decarboxylase [Mycobacterium liflandii 128FXT]
Sequence
MKRYSTRPRRLRVSALAAVANPSYARVDTWNLLDDACCHLAEVDLAGMDITHDMAKVRRL
MDRIGAYERYWLYPGAQNLANFRAHLESKSTVRLKEEVSLAVRLLGEYGDRTALFDTSAP
LAEQELVAQAKQQQFYTVLVADDAPTSAPDSLAEHLRALHNPSDDVQFEVLLAPSVEDAI
TAVALNGEIQAAIIRHDLPLRSRDRLPLMNALLGANDDVVAPDSPHDWIECGEWIRELRP
HIDLYLLTDESIAAGAEDDPDVYDRTFYRLNDVTDLHSTVLAGLRNRFATPFFDALRAYA
AAPVGQFHALPVARGASIFNSKSLQDMGEFYGRNIFMAETSTTSGGLDSLLDPHGNIKKA
MDKAASTWNADHTYFVTNGTSTANKIVVQSLTRPGDIVLIDRNCHKSHHYGLVLAGAYPL
YLDAYPLPPFAIYGAVLLHTIKQVLLDLEAAGQLHKVRMLLSTNCTFDGVVYNPRLVMEE
VLAIKPDICFLWDEAWYAFATAVPWARQRTAMVSAEYLESMLASDEYGAVYEKWRASMQG
IPRSQWAEHRLLPDPKRARVRVYATHSTHKSLSALRQASMIHVRDQDFNALTRDAFGEAF
LTHTSTSPNQQLLASLDLARRQVDIEGFQLVRQVYDMALVFRHRVRKDRLISKWFRILDE
ADLVPEEFRASSVSSYRQVRQGALAEWNEAWRSDQFVLDATRVTLFIGSTGMNGYDFREK
ILMERFGIQINKTSINSVLLIFTIGVTWSSVHYLLDVLRRIATDFDRSQRAASAADWALH
ERRVEEITQDLPHLPDFSEFDIAFRPDDASSFGDMRSAFYAGYDESDREYVQIGMAGRRL
AEGRTLVSTTFVVPYPPGFPVLVPGQVVSKEIVYFLAQLDVKEIHGYNHELGLSVFTDVA
LKRMEAARNVIASAGAELPAFELAPASSVVNGDGVLQAVADDA
Download sequence
Identical sequences L7V8B5
WP_015355832.1.5386 gi|443491083|ref|YP_007369230.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]