SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427711244|ref|YP_007059868.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|427711244|ref|YP_007059868.1|
Domain Number - Region: 94-148
Classification Level Classification E-value
Superfamily ADC synthase 0.0183
Family ADC synthase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427711244|ref|YP_007059868.1|
Sequence length 229
Comment hypothetical protein Syn6312_0071 [Synechococcus sp. PCC 6312]
Sequence
MELAVWHRIKQAIKSDLIAGFLVVIPLATTIWLTFTIARSVIGWLTRIPKQLNPFTAWNP
IILESVNLFVGLAVPLFGILLIGLMARNIVGRWLLEAGEGILTKIPLAGTVYRVLQQLLE
TLLRDSRNRFRRVVLVEYPRPGLWAVGFVTGSIAGALADTFPSPMVSIFIPTSPNPTTGW
YAIAPEQELIGLDISIEDAFKLIISGGIVTPNWTAINPRPEVALTNLPS
Download sequence
Identical sequences K9RMZ8
gi|427711244|ref|YP_007059868.1| WP_015122869.1.5248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]