SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427711303|ref|YP_007059927.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427711303|ref|YP_007059927.1|
Domain Number 1 Region: 6-269
Classification Level Classification E-value
Superfamily Pentein 1.45e-51
Family Dimethylarginine dimethylaminohydrolase DDAH 0.059
Further Details:      
 
Domain Number 2 Region: 619-701
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 0.0000794
Family Pyruvate oxidase and decarboxylase, middle domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427711303|ref|YP_007059927.1|
Sequence length 709
Comment hypothetical protein Syn6312_0130 [Synechococcus sp. PCC 6312]
Sequence
MSSVLRFLMCAPEHYDVDYVINPWMEGNIHKSSQHLAQEQWQGLYTIISKRAEVALVNPE
KGWPDMVFTANAGLVLGDTVVLSRFFHKERQGEEPFFQAWFESQGYTVYTLPQDLPFEGA
GDALLDREGRWLWAGYGFRSELDSHAYLAKWLDIEVLSLRLMDERFYHLDTCFCPLSGGY
LLYYPPAFDAYSNRLIELRVPAEKRIAVIEPDAVNFACNAVNIHQTVILNQASDDLKNAL
NTAGFEVIETPLTEFLKAGGASKCLTLRVTEPVQADIHAQASLETRIIRLEGHLLDSGLI
NRALDVIVEGGGSFQVINFNLGEQRQSTSQAEVRVTAPSRDVMDELMAQLIDLGAIAPPQ
ELCDNSLETVIQDGVAPDDFYVTTIYPTEVRINCEWVRVQGQRMDGAIVVRHTPEGPVAE
CRLLRDLVKGDQVVVGVEGIRTVRKPESREQRGSSQEFSFMGAGVSSERRVELVVEQIAW
ELRRIRDQGGKVVVVAGPVVIHTGGGEHLAKLIREGYVQALLGGNAIAVHDMEQAMMGTS
LGVDMKRGVSVRGGHRHHLKVINQVRRAGTIAAAVEKGWLTQGIMYECVKNQIPFCLAGS
IRDDGPLPDTEMDLIQCQREYSRLIQGADMILMLSSMLHSIGVGNMTPAGVKLVCVDINP
AVVTKLADRGSVESVGVVTDVGLFLSLMVQQLNKLNRPYQQARPGQLVS
Download sequence
Identical sequences K9RQ56
gi|427711303|ref|YP_007059927.1| WP_015122928.1.5248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]