SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427711332|ref|YP_007059956.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427711332|ref|YP_007059956.1|
Domain Number 1 Region: 372-571
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.22e-66
Family Pyruvate oxidase and decarboxylase PP module 0.0000112
Further Details:      
 
Domain Number 2 Region: 190-364
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 5.77e-65
Family Pyruvate oxidase and decarboxylase, middle domain 0.000032
Further Details:      
 
Domain Number 3 Region: 2-179
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.09e-62
Family Pyruvate oxidase and decarboxylase Pyr module 0.00000277
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427711332|ref|YP_007059956.1|
Sequence length 602
Comment acetolactate synthase large subunit [Synechococcus sp. PCC 6312]
Sequence
MRATGAFILLDSLCRHGVECIFGYPGGAILPIYDELYRAEARGDIRHILVRHEQGAAHAA
DGYARATGKVGVCFGTSGPGATNLVTGIATAHMDSIPMVVITGQVPRHAIGTDAFQETDI
YGITLPIVKHSYVVRQGADMARIIAEAFYIAGTGRPGPVLVDIPKDVGLEECTYKPIAPG
SVKLPGYKPTVKGNARQVTQALKLIRQSHRPLLYVGGGAIAAGAHTEIKHLAEQFQIPVT
TTLMGKGAFDETHELALGMLGMHGTAYANFAVSECDLLIAVGARFDDRVTGKLDEFAARA
KVIHIDIDPAEVGKNRAPDVPIVGDVRAVLTELLTLIRDNEPPTMSKTQAWLERIRHWQA
DYPLVVPHPDGKLSPQEVIYQLGVQAPDAFFTTDVGQHQMWAAQFLKNGPRQWISSAGLG
TMGFGLPAAMGAKMAVGQRQVICISGDASFQMNFQELATLAQYGIAVKTVIINNFWQGMV
RQWQEAFYAERYSHSNMEPGMPDFVKLAEAFGVRGLRISHRDELESAITEMLASDGPVLI
DAHVVRNENCYPMVAPGKSNAQMIGLPEKRTLEKAAELIYCPSCGAKTISSHHFCPECGS
KL
Download sequence
Identical sequences K9RPM2
gi|427711332|ref|YP_007059956.1| WP_015122957.1.5248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]