SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427711607|ref|YP_007060231.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427711607|ref|YP_007060231.1|
Domain Number 1 Region: 9-291
Classification Level Classification E-value
Superfamily Folate-binding domain 1.18e-94
Family Aminomethyltransferase folate-binding domain 0.00000069
Further Details:      
 
Domain Number 2 Region: 283-372
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 2.45e-23
Family Aminomethyltransferase beta-barrel domain 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427711607|ref|YP_007060231.1|
Sequence length 375
Comment aminomethyltransferase [Synechococcus sp. PCC 6312]
Sequence
MTHSTSPTLLRTPLFDLHKKSQARIVEFSGWEMPVQYQGIVAEHQAVRQGVGMFDISHMG
KFDLKGENPLTALQPLVPTDLSQLQPGQAKYTVFLNHQGGIVDDLIVYCHSRYLVSLIVN
AATTAKDWAWLQAHLNTTELALENQTDTLVLIALQGPKAVQALQPLVDIPLDGLKNYHHQ
PATIHLPPDSPFPQVPGWIARTGYTGEDGFEIMVPKTVGQDLWQALQKSGVTPCGLGARD
TLRLEAAMALYGQDIDQTTTPLEAGLGWLVNWEKGDFIGRSALEQQKETGVSRQLVGFLM
EERQIPRPHYLIVVEGQTVGSVTSGSLPPTIAQPLGLGYVRTGLANIGQDIGVEIRGKVH
SAKIVPRPFYRRPKS
Download sequence
Identical sequences K9RQD5
gi|427711607|ref|YP_007060231.1| WP_015123232.1.5248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]