SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427711730|ref|YP_007060354.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427711730|ref|YP_007060354.1|
Domain Number 1 Region: 180-640
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.36e-123
Family Amylase, catalytic domain 0.000000003
Further Details:      
 
Domain Number 2 Region: 648-750
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.56e-37
Family alpha-Amylases, C-terminal beta-sheet domain 0.00031
Further Details:      
 
Domain Number 3 Region: 12-114
Classification Level Classification E-value
Superfamily E set domains 1.04e-17
Family E-set domains of sugar-utilizing enzymes 0.0094
Further Details:      
 
Domain Number 4 Region: 139-195
Classification Level Classification E-value
Superfamily E set domains 0.00000000109
Family E-set domains of sugar-utilizing enzymes 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427711730|ref|YP_007060354.1|
Sequence length 755
Comment alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase [Synechococcus sp. PCC 6312]
Sequence
MTISAEQVARIVSNHHDDPFQVLGCHRYEENGRQAWIVRAYLPNAEQVTVLCPEERKEYP
MQPQHHPNFFECVIETPELTNYQLKVKENGHERVIYDPYAFHSSLLTDFDIHLFCEGNHH
RIYEKLGAHLLTVDGVAGVYFAVWAPNARNVSILGDFNSWDGRQHQMARRDGGIWELFIP
GLEDGEHYKYEIKNQAGHIYEKSDPYGFQQEPRPKTASIVTNLNNYQWSDQAWLEQRRNS
EPLTQPVSIYEVHLGSWLHGSMDTPALLPNGEPEPAIPVADLKPWARFLTYRELAAKLIP
YVKDLGYTHIELLPIAEHPFDGSWGYQVTGYFAPTSRYGTPDDFMYFVDQCHQAGIGVIV
DWVPGHFPKDGHGLAFFDGTHLYEHSDPRKGEHKEWGTLVFNYGRHEVRNFLVANALFWF
DKYHIDGIRVDAVASMLYLDYQREGGEWVANEYGGRENLEAANFLRQVNHVLFSYFPGVL
SIAEESTSWPMVSWPTYAGGLGFNLKWNMGWMHDTLDYFSMDPWFRQFHQNNLTFSIWYH
HSENFMLALSHDEVVHGKSHIIGKVPGDRWQKFANVRALFSYMFTHPGKKTMFMGMEFGQ
WNEWNVWGDLEWHLLQYEPHQQLKQCITDLNRLYRQEPALYSQDFGEAGFEWIDCNDNRH
SVVAFVRWAKDYSDFVVVICNFTPQPHSHYRIGVPEHGFYNEIFNSDAREYGGSNMGNLG
GKWADEWVFHNRRYSLDICLPPLAVLVFKIDRAHE
Download sequence
Identical sequences K9RQK3
WP_015123355.1.5248 gi|427711730|ref|YP_007060354.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]