SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427712154|ref|YP_007060778.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427712154|ref|YP_007060778.1|
Domain Number 1 Region: 11-358,390-408
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 4.88e-108
Family B12-dependent (class II) ribonucleotide reductase 0.00011
Further Details:      
 
Domain Number 2 Region: 1120-1462
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 3.05e-100
Family B12-dependent (class II) ribonucleotide reductase 0.001
Further Details:      
 
Domain Number 3 Region: 406-531,696-775
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 8.24e-40
Family Intein (protein splicing domain) 0.017
Further Details:      
 
Domain Number 4 Region: 786-910,1058-1118
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 0.00000000000000179
Family Intein (protein splicing domain) 0.072
Further Details:      
 
Domain Number 5 Region: 605-728
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00000000000000359
Family Intein endonuclease 0.014
Further Details:      
 
Domain Number 6 Region: 983-1089
Classification Level Classification E-value
Superfamily Homing endonucleases 0.000000000000489
Family Intein endonuclease 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427712154|ref|YP_007060778.1|
Sequence length 1469
Comment ribonucleoside-triphosphate reductase, adenosylcobalamin-dependent [Synechococcus sp. PCC 6312]
Sequence
MVQNLPRPVSGTFPATAPAAYPVFYRTYSRRNEEGTRESWLEVSQRTLTGLQELGQLTDA
EVALIAQMQQELKALTSGRWLWVGGTDWVKKPENFSGGYNCTSTNVVDWRAFGLMMDLAM
QGCGTGAVLEDKYIQQLPAIRNPITVAVIGDIGKTPAAERHELTQVEINGNQVNVKVGDS
RQGWVKSYQILLETSTNPQFTGPVHFVVDISDIRPTGESLKGFGGVANPVKLPEMYQRCA
NILNKAVGRQLNSVESCLLIDEAAVVVVAGNVRRSAGMRQGGNNDPEFTAAKQNLWQQDE
NGNWRIDPERDSLRMANHTRVFHRKPNLEETTAAVRQQYYSGEGAIQWAGEAVARANADL
LTTPELKKAFIQAYDQGQAKEFLKNLAPDQAPQELEHRIGRYGLNPCVTAETWIHTGEGP
RQVKDLIGHQHSTYVNGELFSTTPDGFFLTGIKPVVKLQTKAGFSLRLTPNHQVLKVTAQ
TQKKQYSEWVEVGELQPGDRILLHNHREIQPWDGDGTRAEGWLLGSLLGDGSLAKTQWHD
VGILHYWQGSRLEMSNYARELLTASVGYETRVTVAHEHKTLNHRVINSTGLAQLAAKFGL
KPVHKTITPAIEQASYEFYQGFLQGLFDADGSVQGSQVKGVSVRLAQSNLETLQAVQRML
ARLGIIATIYQNRRPEGLRLLPNSQRQTSLYHCQAQHELVISQDNLPHFQELIGFQEPAK
QAKLQQLLSGYQRQLNRERFAVVVEAVIPDGEAPVYDCSVPGPNRFDANGLVAHNCGEII
GADFHCVAGQTLLITRDGMYPIQNLVGQSVEIWNGQRWSSVTPFLTGQDRQLYRVKFSDG
TFLDVTEKHRFFAKHRFAQDYEELTTLELAEKVKISPYKLHTEPFKIAYDTGRFVEPTWA
YTLGQLVGDGSVCQSHGKPQLQLRLYGHKRHQELAIAGRTTGEKRYYTESKEVPCLLYTG
FQNQFDPGQVRALKDTAAAFDPIASWDRESILSFIAGLADADGSEVPSGGIRIYISDYDR
AYRVYLLLLKCGIRSSVNLVQKAETKTNLGVRKKDLWYLQVTDCAAIPCQRLNTSRGHQP
KAKGKHQVIQSVELLPGRHDTFCFNEPEFHKGVFGGTLTGQCNLAEVHLNQIAPNDLESQ
EKAFKAGALSVAALLNHQFQEPRYRYSREIDPIVGVSFTGLFDFFVQALGVEWLNWWTAG
RPDTVQGLDFKEQEATYLKRWRDIVHQTVWDYCDRHGLRRPNRCTTVQPAGTKSLLTGAS
PGWHPPKAQRFIRRITFRKNDPVALACYDYGYNVIPSQSDKDETGNLLNDPFDPRCSEWL
VEIPVAVAWADVPGADQIDISQFSALAQFDFYMQVQTHYTRHNTSATIELRENEVEPLAA
AIHQAIEQDHGYISAALLARFDDLQTFPRLPFEPIDKARYDTEVVAVRQRRRTEDFYGAL
QRYTQPAMEAGPAGCDSDKCMMPETKPAN
Download sequence
Identical sequences K9RQJ8
WP_015123779.1.5248 gi|427712154|ref|YP_007060778.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]