SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427712156|ref|YP_007060780.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427712156|ref|YP_007060780.1|
Domain Number 1 Region: 322-547
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.73e-40
Family ABC transporter ATPase domain-like 0.00016
Further Details:      
 
Domain Number 2 Region: 89-308
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 1.12e-21
Family DNA repair protein MutS, domain III 0.021
Further Details:      
 
Domain Number 3 Region: 744-817
Classification Level Classification E-value
Superfamily SMR domain-like 0.00000011
Family Smr domain 0.011
Further Details:      
 
Weak hits

Sequence:  gi|427712156|ref|YP_007060780.1|
Domain Number - Region: 571-647
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0353
Family Apolipoprotein A-I 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427712156|ref|YP_007060780.1|
Sequence length 817
Comment MutS2 family protein [Synechococcus sp. PCC 6312]
Sequence
MELGLEQLPEFSSSLETSYRFANLHLETKTQALLDWPRLCQHLATFTATKVGAELAQAWQ
PAPNLRDSQQLLAQTEDAYKLTTYYLRELDFSQIKNIQSGLNRAAHQGVLTPEELLGIAQ
TQAGSRNLRRVVDSYPDLSALQALLAALRTFPQLEQEIHRCITEQGEVSERASPQLAAIR
QHQQQMRGQIHQQLQQIIQRKHSSLQDTVITQRAERYVLPVKAPQRDAIPGIVHDVSVTG
ATLYIEPQAIVELNNRLRQLARQGGQEEYRIREVLSQQVTEVVLELQQGLELITQLDLAV
ARARYGLWLNANIPRFVELDEPIHLRNLRHPLLIWQHHQEQGPTVVPITVDIAPPTKVVT
ITGPNTGGKTATLKTLGLVALMAKAGLMIPAAEPVELPWFRQVLADIGDEQSLQHNLSTF
SGHIRTISEILEALTTEANPDNAALVLLDEVGAGTDPSEGTALAIALLTHLADQAQITIA
TTHYGELKALKYQDPRFENASVEFDSETLAPTYRLLWGIPGRSNALAIAQRLGLNPDVIA
AAAQALPADQDQVNQVIAGLEAQRRHQEAKASTASQLLSATEKLHQELLTKTEQLRQREL
HLRQHQAQAVNTAIDQAQAEIAQLIKKLQAGPQTAQAAAQSQAQLSQIQAKYAPPAPKPI
PGYIPQMGERVRIPKLQQTGEIIGLEDDAIAVRLGLMKVMVKLTDIESLAGEKPQISPKA
TQPPPQASTAKANVTIPTLRTESNTLDIRGQRVAAAEILLDEALNQGGTVLWVIHGHGTG
KLRQFVHEHLRHHPLVEKFEFAPQNEGGRGATIVYFR
Download sequence
Identical sequences K9RT08
WP_015123781.1.5248 gi|427712156|ref|YP_007060780.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]