SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427712208|ref|YP_007060832.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427712208|ref|YP_007060832.1|
Domain Number 1 Region: 125-290
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.28e-43
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000397
Further Details:      
 
Domain Number 2 Region: 381-493
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.49e-30
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000211
Further Details:      
 
Domain Number 3 Region: 19-124
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 3.43e-26
Family Duplicated SiR/NiR-like domains 1 and 3 0.00016
Further Details:      
 
Domain Number 4 Region: 262-394
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 8.18e-22
Family Duplicated SiR/NiR-like domains 1 and 3 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427712208|ref|YP_007060832.1|
Sequence length 517
Comment assimilatory nitrite reductase (ferredoxin) precursor [Synechococcus sp. PCC 6312]
Sequence
MANKFEAVKAVKDGLAVQSELEHFAAIGWENIPEDDRDLRLKWLGIFFRPVTPGQFMLRL
RIPHGILTSDQLQAIGEIVQRYGDSGSGDITTRQNLQIRGIRIEDIPDIFDRLQACGLTS
IQSGMDNVRNITGSPVAGIERDELIDTRPLVAQLQAMITNNGQGNSEFSNLPRKFNIALE
GGRDNSVHAEINDIAFVPAYREGVLGFNVLVGGFFSSRRCEAAVPLDAWVTPDQAVIDLC
RAILELFRDHGPRTNRQKSRLMWLIDQWGLAKFRQEVAAKLAFPLLNAAPEDEINWEKRD
HLGVYPQKQPGLNYVGLHIPVGRLYASDFLGLGRLAQTYGSGEVRLTVEQNFILTHIPDA
QLPGLLAEPILSRFGIDPTPLHRSLVSCTGAQFCNFALIETKSRAVAMSTALEAELELSR
PVRIHWTGCPNSCGQPQVADIGLMGTKVRRNGETVDGVDLYLGGKVGKDAKLGTCVRKSI
PCDELQAILADLLIERFDARPRAPAVKTATDPKLILV
Download sequence
Identical sequences K9RSM5
WP_015123833.1.5248 gi|427712208|ref|YP_007060832.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]