SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427712375|ref|YP_007060999.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427712375|ref|YP_007060999.1|
Domain Number 1 Region: 97-466
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.77e-93
Family Amylase, catalytic domain 0.0000681
Further Details:      
 
Domain Number 2 Region: 7-75
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000385
Family AMPK-beta glycogen binding domain-like 0.018
Further Details:      
 
Domain Number 3 Region: 469-550
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0000000000327
Family alpha-Amylases, C-terminal beta-sheet domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427712375|ref|YP_007060999.1|
Sequence length 551
Comment 1,4-alpha-glucan-branching protein [Synechococcus sp. PCC 6312]
Sequence
MTHPIEFQLFAPYNKAVALIGSFSAWEDIPMQQGEDGYFRAQVELEDGTYHYKFRVQSKS
WFVEPDQWLEVVDPYATDIDNSTQNGVVQIKNGKKIVDTYIWKHDDKPLPSDRELVIYEL
HVADFSGGEPDRYVRGKYKHVVEKLDFLADLGINAIELMPLKEYPGDYSWGYNPRYFFAA
ESSYGSTDELKNLIDECHARGIRVIMDGIYNHSESSSPLTQIDHDYWYHHSPRDPDNNWG
PEFNYDFYDENLDVKPAWTFIGDVVRYWIEEYHVDGIRYDAARQIANYDFMHWIVAETKK
TAGVKPFYNIAEHIPETTSITNVDGPMDGCWHDSFRSVITGHICGDMFDIEQLKDVIDCK
RKGFMGTTNVVNYLTNHDHNHILAELGNRNIFNDEAFKRAKLGAAILMTAVGVPLIWMGE
EFGEYKHNTQEQAKVEWALLDNDLNGELFEYYKGLIHLRKNNQALYVENIDFFHEDPNSQ
VLAYTRWNEEGSRVVVVANFSGNFWAGYTVPHFPANGTWHEWTGDYDVESGADNMMIDLA
EYEAKVFVWQG
Download sequence
Identical sequences K9RSD8
gi|427712375|ref|YP_007060999.1| WP_015124000.1.5248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]