SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427712429|ref|YP_007061053.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427712429|ref|YP_007061053.1|
Domain Number 1 Region: 197-310
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 6.02e-31
Family Pentapeptide repeats 0.00046
Further Details:      
 
Domain Number 2 Region: 4-66
Classification Level Classification E-value
Superfamily Chaperone J-domain 0.00000000000000379
Family Chaperone J-domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427712429|ref|YP_007061053.1|
Sequence length 316
Comment putative low-complexity protein [Synechococcus sp. PCC 6312]
Sequence
MLDLAACYRVLELEPGATLEEINQAYKDLVFIWHPDRVPKDNDRLLEKAHEKIKQINQAR
DHLRQQHRNGKVHTRSQTQPYQSSHQNGYPRSTYSTQSHQSPHSTHNHQSNGHHNGSHSH
HQSHSHRQTPNQAHSQTHAGYRHNPAQDYTSNPYDYRSYQTHRPPQSPPKPPPRPPDPPQ
QSTSHPEPDGTNHPRGKDLSGANLRGADLREKDFEGRNLSYADLTGADLSDAFLHRVSFY
RANLSQATLFRANLLNANLSNANLRDANLIGADFSGADLRGADLRGAKVGQGDRILVKLT
GAKLAGAIMPDGRIHS
Download sequence
Identical sequences K9RRE1
WP_015124054.1.5248 gi|427712429|ref|YP_007061053.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]