SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427712434|ref|YP_007061058.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427712434|ref|YP_007061058.1|
Domain Number 1 Region: 21-240
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 4.56e-58
Family PP-loop ATPase 0.00034
Further Details:      
 
Domain Number 2 Region: 219-323
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 4.32e-19
Family MesJ substrate recognition domain-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427712434|ref|YP_007061058.1|
Sequence length 329
Comment tRNA(Ile)-lysidine synthetase [Synechococcus sp. PCC 6312]
Sequence
MSQAWGDVHARIHTNLRQRLLLPNTARILIAVSGGQDSACLLKLLVDLQPHWAWRLEVIH
CNHRWRDDANDNAEFVQALSHRFDLPCHVRVTEQPLTSENQARAWRYAIFGELARELGCA
YVVTGHTATDQAETLLLHLFRGTGLGGLGGMAWSRSLGGAYPDIQLVRPLLDLTRPETAQ
FCQERGLDIWLDSTNANLDLRRNRLRLEIMPQLRQYFNPQADRVLAQTATLCQAEQDYLD
QETQKHYATVVNEEIPGLAVNPLQTLHPALQRCLIRRFLQEIFEITPQFAHVEGVLNLIF
APKNSQSSPLPKGIVAWVDPPWIKFPDLG
Download sequence
Identical sequences K9RRE6
WP_015124059.1.5248 gi|427712434|ref|YP_007061058.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]