SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427712516|ref|YP_007061140.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427712516|ref|YP_007061140.1|
Domain Number 1 Region: 355-536
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.86e-63
Family Pyruvate oxidase and decarboxylase PP module 0.000056
Further Details:      
 
Domain Number 2 Region: 1-166
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 9.97e-53
Family Pyruvate oxidase and decarboxylase Pyr module 0.000026
Further Details:      
 
Domain Number 3 Region: 180-361
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 2.18e-41
Family Pyruvate oxidase and decarboxylase, middle domain 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427712516|ref|YP_007061140.1|
Sequence length 546
Comment thiamine pyrophosphate-dependent protein [Synechococcus sp. PCC 6312]
Sequence
MNTAELLVKCLENEGVEYIFGLPGEENLDVLQALRQSSIKFITTRHEQGAAFMADVYGRL
TGKAGVCLSTLGPGATNLMTGVADANLDGAPLVAITGQVGTDRMHIESHQYLDLVAMFAP
VTKWNAQIVRPSITPEIVRRGFKLAQAEKPGAVHIDLPENIAAMEAIGNPLRTTDHEKTY
ASYQAVQAAAELINQAQNPIVLIGNGVIRGHASAALTHFATELNIPVANTFMGKGGIPYD
HPLALWSVGLQQRDYISCGFDHTDLVIAVGYDLIEYSPKRWNPDGSIKIIHIATTHAEID
SSYIPETEVVGDISDSLYEILKRADRHDKPTPYALHLRQDIVADYMQYARDDGFPIKPQK
LIYDLRQVMGPDDIVISDVGAHKMWMARHYHCQRPNTCLISNGFAAMGIAVPGALAAKLV
HPDRHIVAVTGDGGFMMNFQELETALREGTNFTTIIFNDGGYGLIEWKQHRYFGESAFIK
FGNPDFVKLAESMGLKGYRVESALDFIPILKTALEQDVPTIIDVPVDYSENLRFNQRIGE
ITCSYE
Download sequence
Identical sequences K9RU05
gi|427712516|ref|YP_007061140.1| WP_015124141.1.5248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]