SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427712647|ref|YP_007061271.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427712647|ref|YP_007061271.1|
Domain Number 1 Region: 3-428
Classification Level Classification E-value
Superfamily L-aspartase-like 6.28e-131
Family L-aspartase/fumarase 0.000000000908
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427712647|ref|YP_007061271.1|
Sequence length 431
Comment adenylosuccinate lyase [Synechococcus sp. PCC 6312]
Sequence
MIERYTLAPMGEIWTDAYKLKTWLQVEIAACEAQAELGLIPTEPVERIKANANFDLQRVL
EIEAEVKHDVIAFLTNVNEYVGDAGRYIHLGMTSSDVLDTGLALQLVASLAILSTQLEQL
IQAVRTQAQSHRYTIMVGRSHGIHAEPITLGFKLAGWLAELLRQRQRLCQLHQTIAVGKI
SGAVGTYANISPQVEALTCQKLGLQPDPASTQVISRDRHADYVQVLALLGASLERFAVEI
RNLQRTDVLEVEEYFSKGQKGSSAMPHKRNPIRSERLTGLARLLRGNAMVALENVALWHE
RDISHSAAERVILPDSSITAHFMLVEATELIRTLQVYPENMARNMNLYGGVIFSQRVLLA
LVEKGLTREAAYGLVQRHAHQAWNQEGGNFRQSLATDAEISQHLSEKELADCFDPKQHLS
HLEEIYSRLGI
Download sequence
Identical sequences K9RTD1
gi|427712647|ref|YP_007061271.1| WP_015124272.1.5248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]