SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427712665|ref|YP_007061289.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427712665|ref|YP_007061289.1|
Domain Number 1 Region: 4-316
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.51e-93
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000043
Further Details:      
 
Domain Number 2 Region: 346-481
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 1.14e-28
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427712665|ref|YP_007061289.1|
Sequence length 483
Comment cysteinyl-tRNA synthetase [Synechococcus sp. PCC 6312]
Sequence
MALQLYNTLTRQLQPFHPLQPGRVTIYACGVTVYDYCHLGHARSYLAWDILRRYLAFLGY
GVTYVQNFTDIDDKIINRAQQENITVTEIVQRYIQAYHTDMARLNIRPADHYPQATAVMP
RIIELIQELVAQGYAYPVQGDVYYAVEKFPSYGKLSGRHLEQMSAGASGRVVEMEQKKRH
PLDFALWKAAKPEEMTVYEPWDSPWGLGRPGWHIECSAMVSEAFGGTIDIHAGGMDLIFP
HHENEIAQSEAATQTTLANYWLHNGFVTINTEKMSKSLGNFTTIRALLDSGIDPMAVRLF
ILQAQYRKPLDFTPLALDAATHGWQTLQEGLEFGWTHQDLFTDLDPLPIEPELKTAFQAS
MDDDLNTPAALAVLFDLAKNLQRQHNQIRHTGSSDQPRDHLWQQWHSLVKLAAILGLEVT
PNSAEPEPEPIITDAEIETLIHQRQQAKQAKNFAESDRIRDYLGTLGIKLIDQKGGETRW
LRS
Download sequence
Identical sequences K9RT94
gi|427712665|ref|YP_007061289.1| WP_015124290.1.5248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]