SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427712675|ref|YP_007061299.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427712675|ref|YP_007061299.1|
Domain Number 1 Region: 18-404
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 6.24e-105
Family Pyruvate phosphate dikinase, N-terminal domain 0.011
Further Details:      
 
Domain Number 2 Region: 883-1205
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 1.35e-100
Family Pyruvate phosphate dikinase, C-terminal domain 0.0017
Further Details:      
 
Domain Number 3 Region: 437-568,761-818
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 8.04e-17
Family Intein (protein splicing domain) 0.019
Further Details:      
 
Domain Number 4 Region: 830-885
Classification Level Classification E-value
Superfamily Phosphohistidine domain 0.00000000000119
Family Pyruvate phosphate dikinase, central domain 0.037
Further Details:      
 
Domain Number 5 Region: 649-721
Classification Level Classification E-value
Superfamily Homing endonucleases 0.000000907
Family Intein endonuclease 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427712675|ref|YP_007061299.1|
Sequence length 1211
Comment phosphoenolpyruvate synthase [Synechococcus sp. PCC 6312]
Sequence
MFATPAQAQKFLSDPSQALVLPLNRLCLSDLPLVGGKNASLGEMLQQLTPQGINVPDGFA
TTAYAYRTFILEGGLEPKLRALLSALDVENVPQLRQIGQELRSLILETPFPTSLHTAITQ
AYGEMCQRYGPDTDVAVRSSATAEDLPDASFAGQQETYLNVHGLTGVLKACHSCFASIFT
DRAISYRQIKGFDHLDVALSVGVQKMVRSDLASSGVMFSIDTETGFKDAALITAAYGLGE
NVVQGAVNPDEYLVFKPTLKTGYRPILEKRLGSKEIKMVYDLGGSKLTKNVSVCPEDRAR
FALSDDEILQLGHWACAIEDHYSQLRGSYTPMDIEWAKDGNTGELFIVQARPETVQSQKA
TNVLRSYKLQETGEVLVHGRAVGEMIGQGQARVIMDVRQINEFQAGEVLVTNRTDPDWEP
IMKKASAIVTNQGGRTCFTGDTKILTNQGFMSLSQVYDRGSDGLLTLSFNPQTQGIEWKP
IIDTMKRPNQVIGVSVSQTGKMTHNTLRLTPDHKMINLRNGEFVKTEIQEMLANQEMVVV
AQTIPQLAEHSEQAADLAYFLGGIITDGSIYTTRTHGEVQFIQKDVPEKAAFITTMQAKA
EKLFGKSFTPYEKKASTGMIRGETVTGQATAYRLYSKSIAYQVKELEENIVPMLLQSSPE
VAYQFLAGVIDGDGCYANNRINIYASEENLLQAIIVACMKINTVPQVTQNRQIYNVQIVE
KLPEILSYTQRVKGEVTARTIQTRFFAARQLFDETAMGQVKLRRDQNYLISEQLLEQMDE
FESLRQGDIRMQRVVQVENLQPAEVFNITVADHHNYVVFTEKYTPVLVCNCHAAIIAREM
GIPAIVGCGDATTKLQTGQAVTISCAEGEMGKVYAGLLNFLIDEVALKNLPRTRTQILMN
VGNPEEAFGLAAIPNDGVGLARLEFIIANHIQAHPLALLHFEQLEDYQVKAEIAALTAQY
PHKPDFFVDKLAHGIGTIAAAFYPKPVVVRMSDFKSNEYANLLGGRQFEPQEENPMIGWR
GASRYYDPLYAAGFALECQAMKRVRDEMGLTNVILMIPFCRTPAEGQRVLEEMAKHGLNR
GENGLEVYVMCELPSNVVLADQFSQVFDGFSIGSNDLTQLTLGLDRDSGLVAHLFDERND
AVLRMVAQAIQTAKKHQRKIGICGQAPSDYPEFAQFLVEQGIDSISLNPDSVLKTLLSIA
ETEAQLDNRNF
Download sequence
Identical sequences K9RTA5
WP_015124300.1.5248 gi|427712675|ref|YP_007061299.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]