SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427712774|ref|YP_007061398.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427712774|ref|YP_007061398.1|
Domain Number 1 Region: 1-231
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.6e-68
Family Lesion bypass DNA polymerase (Y-family), catalytic domain 0.0001
Further Details:      
 
Domain Number 2 Region: 237-336
Classification Level Classification E-value
Superfamily Lesion bypass DNA polymerase (Y-family), little finger domain 0.00000275
Family Lesion bypass DNA polymerase (Y-family), little finger domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427712774|ref|YP_007061398.1|
Sequence length 414
Comment nucleotidyltransferase/DNA polymerase [Synechococcus sp. PCC 6312]
Sequence
MFALVDCNNFYVSCERVFKPKLQGQPVVVLSNNDGCVVARSQEVKALGVPMGAPFFKIKD
LVAAHNIQVFWSNYALYGDMSQRVMQTLTYLCPGLEVYSIDEAFLDFSGFQAHPLKQGQA
IRETVLQWTGIPVSIGIAPTKVLAKVANKLAKQNGGVLVLSPSAINSVLASLSVEDIWDI
STRWGQRLRTINITNAAELESANLAMIRQKFNVVMERIVRELRGESCLPLESVINPQQSL
VVSRSFGQPVTTLTELKQAVATYISRATEKLRSKELMTTHVTVFARTNRFQENYESPSAS
MTLLKPTNHTGKLLDVALRCAESMYQAGRAYKKAGVILQGLSPHQAIQHTFFDAPCDEKE
EALMATLDRINQRFGQHTLRYGAIGIKQHWVMRRSQRSPHYTTQWKELWTIQSF
Download sequence
Identical sequences K9RSE6
gi|427712774|ref|YP_007061398.1| WP_015124399.1.5248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]