SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427712928|ref|YP_007061552.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427712928|ref|YP_007061552.1|
Domain Number 1 Region: 9-194
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 3.77e-41
Family Phosphoglucomutase, first 3 domains 0.001
Further Details:      
 
Domain Number 2 Region: 261-391
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.18e-27
Family Phosphoglucomutase, first 3 domains 0.001
Further Details:      
 
Domain Number 3 Region: 394-483
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 2.22e-20
Family Phosphoglucomutase, C-terminal domain 0.006
Further Details:      
 
Domain Number 4 Region: 166-274
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.45e-19
Family Phosphoglucomutase, first 3 domains 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427712928|ref|YP_007061552.1|
Sequence length 486
Comment phosphomannomutase [Synechococcus sp. PCC 6312]
Sequence
MFWQGITSSSPIKFGTDGWRGVIGAEFTFERLIRAAQAAALVLNTTYGPSTHSQQIIVGY
DRRFLAEEFAQAVAETLKDLGFDVLLANQFAPTPAFSWAVKQHKALGALVITASHNPGIY
SGLKVKGAFAGSVPPEVTEKIEEELTRPHLHVQARTGSMTPFDPWPSYCQALQQKVDLPA
IQTAIKTHHLTVWADVMHGSAAGGLGRILGQPIHELNSGRDPLFSGGAPEPIGKYLQASC
ARIRQAAQETQGKTVGLVFDGDADRIAAIDAQGNLLTAQQLIPILIDHLTVQHGYRGEVI
KSISSSDLIPKVVALHGLSLYETPIGFKYIGDRMLMGGDVLLGGEESGGIGYGNHTPERD
ALLSALYVLEAVVKSGLDLAAYYQSLQVKTGFTSYYDRIDLHLPNLAAKDNLQHLLETNP
PQTVLETPVEKLQTIDGFKFHLGDHGWLLIRFSGTEPLLRLYCESISPERVQATLNWAKA
WAETIS
Download sequence
Identical sequences K9RUP7
WP_015124552.1.5248 gi|427712928|ref|YP_007061552.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]