SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427712943|ref|YP_007061567.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427712943|ref|YP_007061567.1|
Domain Number 1 Region: 23-153
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 4.32e-29
Family N-utilization substance G protein NusG, N-terminal domain 0.00017
Further Details:      
 
Domain Number 2 Region: 123-215
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 6.69e-19
Family N-utilization substance G protein NusG, C-terminal domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427712943|ref|YP_007061567.1|
Sequence length 216
Comment transcription antitermination protein nusG [Synechococcus sp. PCC 6312]
Sequence
MVNDLTDSPPIYPTETADIGQSYWYIVQVASGCEKKVKSTIEQRLHTLDVADRIFQVEIP
QTPTIRIKKDGSRTTSEEKVFPGYVLIRVRANTTPEGVLEIDDEAWQVIKNTPNVINFVG
SEQRRASGRGRGHVKPLPLSPAEVARIFKKVEEQEPIHKIDLVLGDKVKVLSGPFKDFEG
DVIEVSPERSKLKVLLSIFGRETSVELEVNQIEKQS
Download sequence
Identical sequences K9RUR1
WP_015124567.1.5248 gi|427712943|ref|YP_007061567.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]