SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427713171|ref|YP_007061795.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427713171|ref|YP_007061795.1|
Domain Number 1 Region: 144-483,512-587
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.76e-134
Family Amylase, catalytic domain 0.000000155
Further Details:      
 
Domain Number 2 Region: 22-154
Classification Level Classification E-value
Superfamily E set domains 5.04e-31
Family E-set domains of sugar-utilizing enzymes 0.0068
Further Details:      
 
Domain Number 3 Region: 601-709
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 7.19e-23
Family alpha-Amylases, C-terminal beta-sheet domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427713171|ref|YP_007061795.1|
Sequence length 709
Comment glycogen debranching protein GlgX [Synechococcus sp. PCC 6312]
Sequence
MSIERIDIHPTHQINGRKLRCGQPFPFGAMLVPGGVNFAIYSSHATTCTLVLFNKKEPQP
FAEIPFPEAFRIGNVFCMTVFDLDYENLEYGYRMDGPNNFQAGHWFDTSKILLDPYAKIV
SGRDVWGVQPDWNDIYQHRGRISFDDFDWQDDRPLDIPLEDMIIYEMHARGFTKDESSGI
KESHRGTFAGIRDKIPYLQELGVNTIELMPIFEFDEFENSRRHPETGELLLNYWGYSTVN
FFAPKAGYAATGKFGMQTDELKTLIKELHKVGIAVILDVVFNHTAEGNERGPTISFRGID
NKTYYMLTPEGYYFNFSGTGNTLNCNNPIVRGMVLDCLRYWTAEFHIDGFRFDLASILGR
DPWGFPLANPPLLETLAFDPILARSKLIAEAWDAGGLYQVGSFPNYGRWAEWNGKYRDSV
RQFIKGDLGLVGEMAQRIQGSPDLYQAAGRPPSTSINFITAHDGFTLADLVSYNGKHNEA
NGEHNNDGANDNYSWNCGIEGPTDNIYVQALRHKLMRNAMAILMVSQGVPMILMGDEFGR
TQYGNNNTYCHDSPLNWLNWNLLEKEKDWFRFVQCCIAFRQSHPVLRNPEHYQNRDYLGT
GLPDISWHGVRAWHADWSNESRVLAFMLCGHHAKGGKVKDNQIYVAMNMHHESLWFELPA
TSVGKAWYVFANTGAHPPEDIHWPGSEPRLDSQSGLLVGDRSLVILLAK
Download sequence
Identical sequences K9RVY9
gi|427713171|ref|YP_007061795.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]