SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427713173|ref|YP_007061797.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427713173|ref|YP_007061797.1|
Domain Number 1 Region: 334-382
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0000000000379
Family HAMP domain 0.0029
Further Details:      
 
Domain Number 2 Region: 426-655
Classification Level Classification E-value
Superfamily PP2C-like 0.0000000228
Family PP2C-like 0.016
Further Details:      
 
Weak hits

Sequence:  gi|427713173|ref|YP_007061797.1|
Domain Number - Region: 210-297
Classification Level Classification E-value
Superfamily Sensory domain-like 0.00628
Family Sensory domain of two-component sensor kinase 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427713173|ref|YP_007061797.1|
Sequence length 657
Comment serine phosphatase RsbU, regulator of sigma subunit [Synechococcus sp. PCC 6312]
Sequence
MTISQDAKPIKSQIQTFRQGVLKKLTQIKHNNPIARSIQLRIVFLLLICLIPVSLGGIYW
LDLYTEERLIKLAELDLVSRGKLLAELMGRLDRERRLDTEFLASHPAVIQFNQKESGVLL
QHFAQFHHWEGNFSVFNMQGKLIAESPKNSFQAFDKIPTWLSESQARGGPMNRLTRNTTI
EDSKDCLIMPIVSPESQKQVGVLLECIPLSAISRFVNDIGKSIDVDRIIFVNYQGWIYAD
TGNIAYSQLENRQNLPAEKRVLSGEQRVTYTDGKFIFTMPIKYRNNRTWGLILINTEETI
QSAIADVNRVGLILVAFIGIIVAYSSWKIIHHSTVPITALTQATSAIADGNLDYVIDIHR
QDEIGTLAQSFMNMQSRLKNLIDQEVKDAVYRLELEKGRQIQQDFLPEHLPEAAGWDIAG
LFEPARSVSGDFYDAFTLDDNYLGLVIGDVCDKGVGAAMFMGLFRSLLRVFSGAGMSSEI
YIDNRGLNDDPTDILDGMDPLVHQFLKAVYLTNDYITTEHSSMAMFATLFFGVLDIKTGT
LTYINAGHEPVYVLNQAGIKHQLKSSGPAVGMMPKSTFPSHHINLELGDLLVGYTDGVTD
ARCPNGKFFGRKRLEQLLIQHYEDHVNILECVRSELLDHIADAVQFDDITMLVVYRN
Download sequence
Identical sequences K9RVC6
WP_015124797.1.5248 gi|427713173|ref|YP_007061797.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]