SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427713265|ref|YP_007061889.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427713265|ref|YP_007061889.1|
Domain Number 1 Region: 209-354
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.24e-18
Family Duplicated SiR/NiR-like domains 1 and 3 0.0029
Further Details:      
 
Domain Number 2 Region: 9-89
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.21e-16
Family Duplicated SiR/NiR-like domains 1 and 3 0.0054
Further Details:      
 
Domain Number 3 Region: 360-454
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 0.000000000000393
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0015
Further Details:      
 
Domain Number 4 Region: 97-268
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000000000213
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427713265|ref|YP_007061889.1|
Sequence length 470
Comment assimilatory nitrite reductase (ferredoxin) precursor [Synechococcus sp. PCC 6312]
Sequence
MSDLPPFTNSLSPVCPGLFYGVTAADGLLLRIRIPGGQLRREQGRGLVALAEHLGVETLQ
ITNRANIQLRGLKEIPRPEVLERLQALGLAAQNPAVDVLRNVMVSPLAGCDPAELVNFAP
WLRELEFFWANHPGLAQLPAKFSIGLDGGGLCSIGQRSATVAEHRYNEIQLTALAVDPEI
APGLETGIYLHLMFGIEKKLIPTGVLVSPEQGLPLIKSLIWAYLDYCQAPDRPPKVRLRE
IMADWGLETFLNQARRYLDFPLTRHPKIPSLPTHPGQQHLGIHPQAEPEQVYIGIGLPQG
QLTKDQLRGLVGLASEFGSGDLRLTPWHSVLIVNTPSLQIPAVIEQLSQFNLSPFPENPQ
GIVACAGKPGCAAAQTPTQADAQVLGGYLESLSLTTPVNIHLTACPKACAQPSPAEITLL
GIGPDIYRLYLGDLRDDQAPVMAQQPLAELLPLIAATLGPKSGPAHSSRL
Download sequence
Identical sequences K9RV01
WP_015124889.1.5248 gi|427713265|ref|YP_007061889.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]