SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427713383|ref|YP_007062007.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427713383|ref|YP_007062007.1|
Domain Number 1 Region: 1-61
Classification Level Classification E-value
Superfamily TTHA1013/TTHA0281-like 0.0000000000034
Family TTHA1013-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427713383|ref|YP_007062007.1|
Sequence length 81
Comment hypothetical protein Syn6312_2354 [Synechococcus sp. PCC 6312]
Sequence
MLYKIPILLTPQPEGGFTVTSPLFPELITEGDSMPDVIANVRDAFTSVLELYEDFGKPLP
NGLEIIDQKTPALIETIISTS
Download sequence
Identical sequences K9RW20
gi|427713383|ref|YP_007062007.1| WP_015125007.1.5248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]