SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427713432|ref|YP_007062056.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427713432|ref|YP_007062056.1|
Domain Number 1 Region: 143-419
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 9.34e-124
Family Enolase 0.000000035
Further Details:      
 
Domain Number 2 Region: 5-140
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.77e-54
Family Enolase N-terminal domain-like 0.00000759
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427713432|ref|YP_007062056.1|
Sequence length 428
Comment enolase [Synechococcus sp. PCC 6312]
Sequence
MLDTAIVAIHGREILDSRGRPTVEAEVELACGIIGLAQVPSGASTGSFEAHELRDGDKSR
YGGKGVLQAVDNIEEKILPVLIDFDAADQTGLDHLMIDLDGSANKSNLGANAILAVSLAA
AKACAFALDVPLYRYLGGPLANLLPVPLMNVINGGAHADNNVDIQEFMIVPAGASSFKEA
LRWGAEVFAALSSVLKDQGLLTGVGDEGGFAPNLSSNRAALDILMKSIELAGFKPGDEVA
LALDVAASEFYADGKYTYDGVTRNPIDLIDYLGELVDAYPIVSIEDGLHEDDWENWKILT
QKLGSKIQLVGDDLFVTNPIRFKRGIDQHIGNSILIKLNQIGTLTETLETIDLATRNAYR
SVISHRSGETEDTTIADLAVATRAGQIKTGSLCRSERVAKYNRLLRIEDDLGESAVYAGA
VGFGPGTR
Download sequence
Identical sequences K9RVM4
WP_015125056.1.5248 gi|427713432|ref|YP_007062056.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]