SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427713540|ref|YP_007062164.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427713540|ref|YP_007062164.1|
Domain Number 1 Region: 1-237,276-323
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 3.33e-74
Family Cytidylytransferase 0.0056
Further Details:      
 
Domain Number 2 Region: 246-428
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 7.53e-29
Family GlmU C-terminal domain-like 0.069
Further Details:      
 
Domain Number 3 Region: 636-743
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.29e-19
Family Phosphoglucomutase, first 3 domains 0.004
Further Details:      
 
Domain Number 4 Region: 531-633
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 0.0000000000279
Family Phosphoglucomutase, first 3 domains 0.0022
Further Details:      
 
Domain Number 5 Region: 746-830
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 0.000000000706
Family Phosphoglucomutase, C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427713540|ref|YP_007062164.1|
Sequence length 840
Comment Nucleoside-diphosphate-sugar pyrophosphorylase family protein [Synechococcus sp. PCC 6312]
Sequence
MRAVLMAGGSGTRLRPLTCELPKPMVPLLNRPIAEHILNLLRRHQLTEVIITLHYLPDVV
REYFGDGHEFGVDITYAVEEDYPLGTAGCVKNIASLLTETFFVVSGDSVTDFDLTAALAF
HRQHQAPATLVLTSVSNPKEFGVVITDEQGRISRFLEKPSPGEIFSDTVNTGIYILEPEV
LDYLPSGIERDFSKDLFPLLLQSQIPLYGYVAQGYWCDVGSLETYQQVQYDALQERVKLE
PVGRELYPQIWVGHNSIIHPRAILRPPLLIGHNCRVQGDVCLESGTVLGDNVIIGSRSHL
NQAIVWGGSVIGEEGVLDSCIIGRRVRVDRHAIVQEGAVIGSRTRIGEESVIGRGVRIWP
GKQIEAGARVNQSLIWGSTGQRNLFGYQGVAGLANVDITPEFAVRLAAAYASTLEPGTSV
LISRDQRSVSRMIANALIAGLMSVGINVLCLEAIALPISRFAVQSLSVCGGIHVRLHPDR
DEQLLIEFFDHKGINLNQTKQRQIETAYFREDMRRVSFTDVGRITYPSQIVEIYAQGFGK
WLNTQALQQYECKIVLDYAYAVSGAVLPELLNKFGSDVVVLNATVHQTPPNTEERQGLLQ
ELGQVVQAIQANLGVQVSANGERLTLVDDRGQTIVGEELTALMADLVLSAYPGGTVIIPV
HISSAIEVIARKHGGSVMRTRANPTDLMEACQKQVGAVLGGSAETGFIFPQLHPGYDAMF
SIAKLMEMLALRQQPLSEIRQNLPQVFHTHQALRCPWIAKGSLMRHLVETHSPTTLNLVD
GVKILHRDGNDWVLVLPDASEPLVHLFVNGREQAWTEQMNHDYRQRIHEFAHLEPSEIGV
Download sequence
Identical sequences K9RVQ8
WP_015125164.1.5248 gi|427713540|ref|YP_007062164.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]