SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427713598|ref|YP_007062222.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427713598|ref|YP_007062222.1|
Domain Number 1 Region: 2-224,345-392
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.43e-84
Family Tandem AAA-ATPase domain 0.0000000786
Further Details:      
 
Domain Number 2 Region: 703-921
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 4.05e-70
Family Helical scaffold and wing domains of SecA 0.00000967
Further Details:      
 
Domain Number 3 Region: 395-502,601-701
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.71e-52
Family Tandem AAA-ATPase domain 0.00000632
Further Details:      
 
Domain Number 4 Region: 223-345
Classification Level Classification E-value
Superfamily Pre-protein crosslinking domain of SecA 1.22e-44
Family Pre-protein crosslinking domain of SecA 0.0000371
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427713598|ref|YP_007062222.1|
Sequence length 929
Comment protein translocase subunit secA [Synechococcus sp. PCC 6312]
Sequence
MLKAIFGDPNQRKLKKYQPLVSDINLLEEDIQPLSDAELQAKTGEFKQRLEKGETLDDLL
PEAFAVVREASRRVLGLRHFDVQLIGGMILHDGQIAEMKTGEGKTLVSTLPAYLNALTGK
GVHIITVNDYLARRDAEWMGQVHRFLGLTVGLIQQQMPPQERQKSYACDITYATNSEIGF
DYLRDNMATSMAEVVQRPFHFCVIDEVDSVLIDEARTPLIISGQVERPTEKYLKASEIAR
SLNAEVHYEVDEKARNVLMTDEGFIEAEKLLGVDDLFDPEDPWAHYIFNAIKAKELFIKD
VNYIIRGEEIVIVDEFTGRVMPGRRWSDGLHQAIEAKERVEIQNESQTLATITYQNLFLL
YPKLGGMTGTAKTEEAELEKIYKLEVTVVPTNRTSSRRDISDVVYKTEMAKWQAVAQECA
EMHSAGRPVLVGTTSVEKSEILSVLLQQQGIPHNLLNAKPENVERESEIIAQAGRKGAVT
ISTNMAGRGTDIILGGNAEYMARLKVREFFMPRIVMPESDDPMSLLSLMGNHRQGGQGFG
QEVKQKSWKVSTEIFPTEISKDAEALIRAAVDFAVKEYGERSLPELQAEDMIAVAAEKAP
TQDPVIQKLREAYNQIRREYEAFTGREHQEVVELGGLHVIGTERHESRRIDNQLRGRAGR
QGDPGSTRFFLSLEDNLLRIFGGDRVASLMNAFRVEEDMPIESRILTGSLENAQKKVETY
YYDIRKQVFEYDEVMNNQRRAIYAERRRVLEGEDLKDRVLEYAEKTMDDIVVAYVNPELP
AEEWDLASLVSKVQEFVYLLADLEPEHLANLSVAEMQLFLHEQVRTAYERKEAEIDQIQA
GLMRQAERFFILQQIDTLWREHLQQMDALRESVGLRGYGQEDPLVEYKREGYEIFLDMMI
MIRRNVVYSLFQFQPQMPATTTEVTTEVV
Download sequence
Identical sequences K9RWL4
gi|427713598|ref|YP_007062222.1| WP_015125222.1.5248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]