SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427713603|ref|YP_007062227.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427713603|ref|YP_007062227.1|
Domain Number 1 Region: 3-243
Classification Level Classification E-value
Superfamily Hsp33 domain 7.46e-67
Family Hsp33 domain 0.00000406
Further Details:      
 
Domain Number 2 Region: 235-293
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 4.58e-17
Family HSP33 redox switch-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427713603|ref|YP_007062227.1|
Sequence length 302
Comment disulfide bond chaperone [Synechococcus sp. PCC 6312]
Sequence
MPDQLIRATAAAEGIRAVGVITTRLTEEARQRHQLSYVATAALGRTMAAGLLLASNMKQP
QARVNIRVQGNGPLGIVFADAGCDGTVRGYVQNPEIELPPNQSGKLDVGGAVGASGFLYV
IRDIGYGYPYSSTVELVSGEIGDDVTYYLATSEQTPSALMLGVFVGQNGTEAAGGILLQI
LPQAVENEALIATLESRVAALQGFTPMLRAGKTLPEMFEQLLGDLDLKILPQNQLLRFHC
GCTHERMLGALKILGEAELKDILMTETFAEATCHFCNEVYHANSRELEQLLAELQQETAT
SS
Download sequence
Identical sequences K9RWL9
WP_015125227.1.5248 gi|427713603|ref|YP_007062227.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]