SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427713691|ref|YP_007062315.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427713691|ref|YP_007062315.1|
Domain Number 1 Region: 2-142
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 8.63e-40
Family N-terminal domain of MutM-like DNA repair proteins 0.00018
Further Details:      
 
Domain Number 2 Region: 137-226
Classification Level Classification E-value
Superfamily S13-like H2TH domain 9.94e-30
Family Middle domain of MutM-like DNA repair proteins 0.0011
Further Details:      
 
Domain Number 3 Region: 226-277
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.94e-17
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427713691|ref|YP_007062315.1|
Sequence length 280
Comment formamidopyrimidine-DNA glycosylase Fpg [Synechococcus sp. PCC 6312]
Sequence
MPELPEVETVRRGLAELTLDVPILGGEVLYPKTVAYPLDPDEFISGLVGQSLQAWERRGK
YLIGKLNSRGWLVVHLRMTGQLFWLSQEIPMAKHTRVRLFFGSGQELRFVDQRTFGQMWW
LPAADLLPQLMPTLAGLGPEPLGPDFTVSYLAQKLQHPHKPIKNALLDQALIAGIGNIYA
DEALFLAQIHPQARCCDLTPVQIQTLHQKIKAVLQLSLAVGGTTFNTFTSVEGINGNYGG
QAWVYGRKGQPCRVCQTPIQQIRLGGRSAHFCPQCQPLTN
Download sequence
Identical sequences K9RXH8
gi|427713691|ref|YP_007062315.1| WP_015125314.1.5248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]