SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427713784|ref|YP_007062408.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427713784|ref|YP_007062408.1|
Domain Number 1 Region: 801-1028
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 7.46e-49
Family Multidrug efflux transporter AcrB transmembrane domain 0.00047
Further Details:      
 
Domain Number 2 Region: 300-503
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 4.84e-37
Family Multidrug efflux transporter AcrB transmembrane domain 0.00014
Further Details:      
 
Domain Number 3 Region: 42-133
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 1.57e-24
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0019
Further Details:      
 
Domain Number 4 Region: 718-803
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 1.14e-17
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0068
Further Details:      
 
Domain Number 5 Region: 191-273
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00000000000000432
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0043
Further Details:      
 
Domain Number 6 Region: 155-190,276-326
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0000000000000141
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427713784|ref|YP_007062408.1|
Sequence length 1055
Comment heavy metal efflux pump [Synechococcus sp. PCC 6312]
Sequence
MLNGILKWSIAQRWLVVIGAIIVTILGSYNLTQMPLDVFPQFAPPQVEIQTEAPGLAPEE
VESLVTLPIESAINGTPGIETVRSSSAVGISVVRAIFSWDTDVYRARQLVTERLQQAQTK
LPAGVETPAISPISSPIGTILMYALTVKNEDGATPTTDLMEVRRLVDRTITNQLLAVPGV
SNVLTYGGDIRQYQVLVDPAKLQAFDVSLDDVTLAAEQANLNGAGGFLIGPDQEEIIRGI
GRIESLEDLANSVITSRNGVPIRLGDVAQVQIGAALARGDGSVNGQRAVVMVIDKQPQAD
TPTVTRDVERTMAAIKAGLPEDVEVIETFRQENFIAAATDNVRDSLRDGIIIVSVVMLLF
LMNWRTAVITLSAIPLSVLIGLLILNGLGQGINTMTLGGLAVAIGSVVDDSIVDMENCYR
GLRENQAQGNPKHPLQVVYDTSVEVRTSVIFSTVIIVVVFAPIFTLTGVEGRIFAPMGVA
YLVSILASTFVAMTLSPALCAFLLAPRQLPSDETWVSAFSQRFYRPLLNLAIHKPKRILY
IALGLFLAAMLILPMLGRVFLPEFQERSLVNAMLLYPGSSLEATNRVGLAMQDALKDDPR
FRSVQLRAGRAPGDSDAGGVNLGHLDVELSDLGIKDREGSIETIREEFNKLPGVAPNIGG
FISHRMDEVLSGVRSAIAVKIFGPDLNQLRQIGQDVEAAMRDIPGLVDLQLEPQVPIRQV
QIQFDRAQASRYGLTVGQLAETIETAFNGRVVSQVLQEQQLFDLVVWLQPEARNNIETFR
NLLISTPTGSKIPLAQVAQVNYDTGPNTINRENVSRLLVVSSNVSGRDLRSAVNEIQAKI
AETVTVPSGYVIQYGGQFESEERATQNLILYGGLAIVIIAILMYFAVKSIPAMLMIMINL
PLALAGGVFAIAVTGAVISVSSLVGFVTLFGVAVRNGLLLVDNYNQKFALGLPLKQVIAA
GSMERLVAILMTALTSALGMLPLAWGTGAGKEVLQPLAIVVLGGLFTSTALTLLVLPALY
AQFGRYFLPKTALEPELEEFNPPGPGEPLNVSQVP
Download sequence
Identical sequences K9RVB7
gi|427713784|ref|YP_007062408.1| WP_015125407.1.5248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]