SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427713886|ref|YP_007062510.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|427713886|ref|YP_007062510.1|
Domain Number - Region: 136-174
Classification Level Classification E-value
Superfamily E set domains 0.0329
Family Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427713886|ref|YP_007062510.1|
Sequence length 242
Comment hypothetical protein Syn6312_2904 [Synechococcus sp. PCC 6312]
Sequence
MFNRIFVLTALLSLLPTAVFAAPTKFTNPTTNRAEVNITGFTAGQEVPIEFQSVTKSVKA
SCLIGSDRYALVSSDVAAEINQPFEAFATAGGTPAIKVNGGENIWGSEEGMTNGRCAFVN
GTRVFVAPNAQGQAVPVTGNYGPLFVTSTVNAEGNVTGKSSLWVRVPTWDAVPVQIVGGN
TQKKYKANSCGIVRFAETETAPLAPTFKVGSTIYTVANLSTAYPPKCYKTGETSYTLFVP
AQ
Download sequence
Identical sequences K9RY24
gi|427713886|ref|YP_007062510.1| WP_015125509.1.5248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]