SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427714085|ref|YP_007062709.1| from Synechococcus sp. PCC 6312

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427714085|ref|YP_007062709.1|
Domain Number 1 Region: 9-238
Classification Level Classification E-value
Superfamily Folate-binding domain 3.14e-50
Family Aminomethyltransferase folate-binding domain 0.0037
Further Details:      
 
Weak hits

Sequence:  gi|427714085|ref|YP_007062709.1|
Domain Number - Region: 246-315
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.0249
Family Aminomethyltransferase beta-barrel domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427714085|ref|YP_007062709.1|
Sequence length 325
Comment folate-binding protein YgfZ [Synechococcus sp. PCC 6312]
Sequence
MKTDSLASACYDCSHWGRILLRGADRLRFLHNQSSNHLNLLKPGQGCDTVILTSTARTLD
LVTAWVRSDDILLLVSPQRREPLQKWLDKYIFFGDQVELQDITPTTSCWRFLGTDCEQIF
RNLGLDLSDLQQLGDHRQYHIADCPVEISFGSGLALPGLTLTVPIEYRLPVMAQIKLAQP
ELMELSETDWEHLRILQGRPAVDAELTEDYNPLEARLDYTISLDKGCYIGQETIARLNTY
QGVKQQLWGLALTDDVEPGTPLRLEGTKVGVLTSCTSLDHPLDHQSKAFGLGYIKTKAGG
VGLQVEAGTTMGQVVDVPFLGAARA
Download sequence
Identical sequences K9RXA1
WP_015125707.1.5248 gi|427714085|ref|YP_007062709.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]